PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta011968
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HD-ZIP
Protein Properties Length: 175aa    MW: 20075.2 Da    PI: 5.9536
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-74017PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-182481056
               HHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox 10 eqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               eq+++Le+ Fe+ + p a ++eeLA  lgL+ +q+ +WFqNrRak+k
  Pta011968  2 EQTRALENSFESGKIPEAGRKEELAGALGLQPTQIAIWFQNRRAKWK 48
               8*********************************************9 PP

2HD-ZIP_I/II96.33e-31286993
  HD-ZIP_I/II  9 eqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93
                 eq ++LE+sFe+ +  e  rK+ela +Lglqp q+a+WFqnrRA++kt qlEkdy++L ++y +lk++ ++L +e+++Lr+e+++
    Pta011968  2 EQTRALENSFESGKIPEAGRKEELAGALGLQPTQIAIWFQNRRAKWKTAQLEKDYRSLNQNYGSLKAQYHTLLEENKKLRSEIQR 86
                 9********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003898.9E-10154IPR001356Homeobox domain
PROSITE profilePS5007116.196150IPR001356Homeobox domain
CDDcd000861.24E-13148No hitNo description
SuperFamilySSF466894.28E-17262IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-19257IPR009057Homeodomain-like
PfamPF000461.4E-15248IPR001356Homeobox domain
PRINTSPR000311.2E-62130IPR000047Helix-turn-helix motif
PROSITE patternPS0002702548IPR017970Homeobox, conserved site
PRINTSPR000311.2E-63046IPR000047Helix-turn-helix motif
PfamPF021832.0E-115186IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MEQTRALENS FESGKIPEAG RKEELAGALG LQPTQIAIWF QNRRAKWKTA QLEKDYRSLN  60
QNYGSLKAQY HTLLEENKKL RSEIQRSGSI SKNGQSRHDK EVMGDGQTDF NAVQEKKVEC  120
YSFHNTEDNI RHQVCIEENC GHNALVAIEE EDCYRNMGGV SSFMFEDHWT PGFQG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.18960.0root| shoot
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.14e-28homeobox 3